Sale!

LL-37 (Human)

Original price was: $149.00.Current price is: $37.25.

SKU: PW14836853651 Category:

Description

LL-37 (Human) Research Use Only

LL-37 (Human) is a 37-amino acid cationic antimicrobial peptide (human cathelicidin) supplied as a 100 g lyophilized powder (Catalog MDP0805, MW 4493.2 g/mol). This biotechnology-grade peptide plays a central role in innate immunity, exhibiting broad-spectrum antimicrobial activity, immunomodulatory functions, and involvement in wound healing, inflammation regulation, and anti-cancer effects.

Catalog number: MDP0805
CAS Number: N/A
Sequence: Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser
Amount: 100 g
Molecular Weight: 4493.2 g/mol
Supplied as: Powder
Applications: Antimicrobial activity studies, immunomodulation, wound healing, inflammation research, anti-cancer mechanisms, and innate immunity
Storage: -20 C
WARNING: For in vitro Research Use Only. NOT for use on humans or animals.
Grade: Biotechnology grade. All products are highly pure.

Scientific Overview

LL-37 is the only known human member of the cathelicidin family of antimicrobial peptides. It is proteolytically cleaved from the precursor protein hCAP18 and exhibits potent broad-spectrum antimicrobial activity against bacteria, viruses, fungi, and parasites. Beyond direct microbicidal effects, LL-37 modulates immune responses, promotes wound healing and angiogenesis, regulates inflammation, and exhibits anti-tumor activity in various models. Its multifunctional nature makes it a key research target in innate immunity, infectious diseases, chronic inflammation, and oncology.

This LL-37 (Human) is suitable for:

  • Antimicrobial and anti-biofilm activity studies
  • Immunomodulation and inflammation research
  • Wound healing and tissue repair models
  • Anti-cancer and angiogenesis studies
  • Innate immunity and host defense mechanism investigations

Usage & Handling Guidance

Store the lyophilized powder at -20 C. Reconstitute in sterile ultrapure water or appropriate buffer (e.g., PBS or 0.1% acetic acid) to the desired concentration. Prepare single-use aliquots to avoid repeated freezethaw cycles. The peptide is sensitive to proteases; use protease-free conditions when possible.

  • Recommended applications: Antimicrobial assays, cell-based immunomodulation studies, and wound healing models
  • Working concentration: Typically 150 M (optimize for specific assay and cell type)
  • Stability: Lyophilized form is stable at -20 C; reconstituted solutions should be used promptly or stored frozen
  • Handling: Use sterile techniques; protect from repeated freezethaw cycles

What You Get

  • 100 g synthetic human LL-37 peptide as lyophilized powder
  • Full-length 37-amino acid sequence ([LL-37, 37 aa])
  • Molecular weight 4493.2 g/mol
  • High-purity biotechnology-grade material for sensitive biological assays
  • For research use only (RUO)

Why Researchers Choose It

  • Authentic human cathelicidin LL-37 with full biological sequence
  • Multifunctional peptide with potent antimicrobial, immunomodulatory, and wound-healing properties
  • Essential tool for innate immunity, infection, inflammation, and cancer research
  • High-purity lyophilized format ensures stability and reproducibility
  • Well-documented in thousands of studies across multiple disciplines

Frequently Asked Questions (FAQ)

  • What is LL-37?
    LL-37 is the active form of the only human cathelicidin antimicrobial peptide, derived from the precursor hCAP18.
  • What are its main biological activities?
    It has direct antimicrobial effects, modulates immune responses, promotes wound healing and angiogenesis, and exhibits anti-inflammatory and anti-tumor properties.
  • How should I reconstitute the powder?
    Dissolve in sterile ultrapure water, PBS, or 0.1% acetic acid. Prepare aliquots and store at -20 C to avoid repeated freezethaw cycles.
  • What concentration is typically used in experiments?
    Working concentrations usually range from 150 M depending on the assay (optimize empirically).
  • Is this suitable for in vivo studies?
    This product is for research use only (RUO) and not intended for therapeutic or clinical applications.

This product is for Research Use Only (RUO). It is not intended for diagnostic or therapeutic use in humans or animals.

References

  • Chen X, Zou X, Qi G, Tang Y, Guo Y, Si J, Liang L. Roles and Mechanisms of Human Cathelicidin LL-37 in Cancer. Cell Physiol Biochem. 2018;47(3):1060-1073.
  • Wang G, Narayana JL, Mishra B, Zhang Y, Wang F, Wang C, Zarena D, Lushnikova T, Wang X. Design of Antimicrobial Peptides: Progress Made with Human Cathelicidin LL-37. Adv Exp Med Biol. 2019;1117:215-240.
  • Ridyard KE, Overhage J. The Potential of Human Peptide LL-37 as an Antimicrobial and Anti-Biofilm Agent. Antibiotics (Basel). 2021 May 29;10(6):650.
  • Aloul KM, Nielsen JE, Defensor EB, Lin JS, Fortkort JA, Shamloo M, Cirillo JD, Gombart AF, Barron AE. Upregulating Human Cathelicidin Antimicrobial Peptide LL-37 Expression May Prevent Severe COVID-19 Inflammatory Responses and Reduce Microthrombosis. Front Immunol. 2022 May 12;13:880961.
  • Wei X, Zhang L, Yang Y, Hou Y, Xu Y, Wang Z, Su H, Han F, Han J, Liu P, Hu S, Koci MD, Sun X, Zhang C. LL-37 transports immunoreactive cGAMP to activate STING signaling and enhance interferon-mediated host antiviral immunity. Cell Rep. 2022 May 31;39(9):110880.
  • Jacobsen AS, Jenssen H. Human cathelicidin LL-37 prevents bacterial biofilm formation. Future Med Chem. 2012 Aug;4(12):1587-99.
  • Suzuki K, Ohkuma M, Someya A, Mita T, Nagaoka I. Human Cathelicidin Peptide LL-37 Induces Cell Death in Autophagy-Dysfunctional Endothelial Cells. J Immunol. 2022 May 1;208(9):2163-2172.
  • Mndez-Samperio P. The human cathelicidin hCAP18/LL-37: a multifunctional peptide involved in mycobacterial infections. Peptides. 2010 Sep;31(9):1791-8.
  • Chieosilapatham P, Ikeda S, Ogawa H, Niyonsaba F. Tissue-specific Regulation of Innate Immune Responses by Human Cathelicidin LL-37. Curr Pharm Des. 2018;24(10):1079-1091.
  • Snchez-Pea FJ, Romero-Tlalolini ML, Torres-Aguilar H, Cruz-Hernndez DS, Baltirrez-Hoyos R, Snchez-Aparicio SR, Aquino-Domnguez AS, Aguilar-Ruiz SR. LL-37 Triggers Antimicrobial Activity in Human Platelets. Int J Mol Sci. 2023 Feb 1;24(3):2816.